SCOPe 2.05: Domain d1wtla_: 1wtl A:

Lineage for d1wtla_ (1wtl A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1wtla_: 1wtl A: [20530]
   VL dimer of Bence-Jones protein WAT

Details for d1wtla_

PDB Entry: 1wtl, 1.9 Å

PDB Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers

PDB Compounds: (A:) bence-jones protein mcg (light chain)

SCOPe Domain Sequences for d1wtla_:

Sequence; same for both SEQRES and ATOM records:

>d1wtla_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr

Timeline for d1wtla_:

• d1wtla_ first appeared (with stable ids) in SCOP 1.55
  
• d1wtla_ appears in SCOPe 2.04
  
• d1wtla_ appears in SCOPe 2.06
  
• d1wtla_ appears in the current release, SCOPe 2.08