Lineage for d2ombb2 (2omb B:113-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752223Domain d2ombb2: 2omb B:113-217 [205297]
    Other proteins in same PDB: d2omba1, d2ombb1, d2ombc1, d2ombd1
    automated match to d1aqkl2
    complexed with iph, so4

Details for d2ombb2

PDB Entry: 2omb (more details), 2.9 Å

PDB Description: bence jones kwr protein- immunoglobulin light chain dimer, p3(1)21 crystal form
PDB Compounds: (B:) Bence Jones KWR Protein - Immunoglobulin Light Chain

SCOPe Domain Sequences for d2ombb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ombb2 b.1.1.2 (B:113-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d2ombb2:

Click to download the PDB-style file with coordinates for d2ombb2.
(The format of our PDB-style files is described here.)

Timeline for d2ombb2: