| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries) |
| Domain d2olkc1: 2olk C:0-240 [205290] Other proteins in same PDB: d2olka2, d2olkb2, d2olkc2, d2olkd2 automated match to d1b0ua_ complexed with at4 |
PDB Entry: 2olk (more details), 2.1 Å
SCOPe Domain Sequences for d2olkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2olkc1 c.37.1.0 (C:0-240) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
qmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegeii
idginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakame
lldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsvm
kqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflskv
f
Timeline for d2olkc1: