Lineage for d4bjlb1 (4bjl B:2-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741627Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)
  8. 2741639Domain d4bjlb1: 4bjl B:2-111 [20529]
    Other proteins in same PDB: d4bjla2, d4bjlb2
    VL dimer of Bence-Jones protein LOC

Details for d4bjlb1

PDB Entry: 4bjl (more details), 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water
PDB Compounds: (B:) loc - lambda 1 type light-chain dimer

SCOPe Domain Sequences for d4bjlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bjlb1 b.1.1.1 (B:2-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
svltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvsd
rfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

SCOPe Domain Coordinates for d4bjlb1:

Click to download the PDB-style file with coordinates for d4bjlb1.
(The format of our PDB-style files is described here.)

Timeline for d4bjlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bjlb2