Lineage for d2olka_ (2olk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849854Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)
  8. 1849855Domain d2olka_: 2olk A: [205288]
    automated match to d1b0ua_
    complexed with at4

Details for d2olka_

PDB Entry: 2olk (more details), 2.1 Å

PDB Description: abc protein artp in complex with adp-beta-s
PDB Compounds: (A:) Amino acid ABC transporter

SCOPe Domain Sequences for d2olka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2olka_ c.37.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
vf

SCOPe Domain Coordinates for d2olka_:

Click to download the PDB-style file with coordinates for d2olka_.
(The format of our PDB-style files is described here.)

Timeline for d2olka_: