![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (79 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries) |
![]() | Domain d2ohfa1: 2ohf A:16-304 [205272] Other proteins in same PDB: d2ohfa2 automated match to d1ni3a1 complexed with acp |
PDB Entry: 2ohf (more details), 2.7 Å
SCOPe Domain Sequences for d2ohfa1:
Sequence, based on SEQRES records: (download)
>d2ohfa1 c.37.1.0 (A:16-304) automated matches {Human (Homo sapiens) [TaxId: 9606]} igrfgtslkigivglpnvgkstffnvltnsqasaenfpfctidpnesrvpvpderfdflc qyhkpaskipaflnvvdiaglvkgahngqglgnaflshisacdgifhltrafedddithv egsvdpirdieiiheelqlkdeemigpiidklekvavrggdkklkpeydimckvkswvid qkkpvrfyhdwndkeievlnkhlfltskpmvylvnlsekdyirkknkwlikikewvdkyd pgalvipfsgalelklqelsaeerqkyleanmtqsalpkiikagfaalq
>d2ohfa1 c.37.1.0 (A:16-304) automated matches {Human (Homo sapiens) [TaxId: 9606]} igrfgtslkigivglpnvgkstffnvltndpnesrvpvpderfdflcqyhkpaskipafl nvvdiaggnaflshisacdgifhltravdpirdieiiheelqlkdeemigpiidklekva kpeydimckvkswvidkpvrfyhdwndkeievlnkhlfltskpmvylvnlsekdyirkkn kwlikikewvdkydpgalvipfsgalelklqelsaeerqkyleanmtqsalpkiikagfa alq
Timeline for d2ohfa1: