Lineage for d2ohfa1 (2ohf A:16-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114368Domain d2ohfa1: 2ohf A:16-304 [205272]
    Other proteins in same PDB: d2ohfa2
    automated match to d1ni3a1
    complexed with acp

Details for d2ohfa1

PDB Entry: 2ohf (more details), 2.7 Å

PDB Description: crystal structure of human ola1 in complex with amppcp
PDB Compounds: (A:) GTP-binding protein 9

SCOPe Domain Sequences for d2ohfa1:

Sequence, based on SEQRES records: (download)

>d2ohfa1 c.37.1.0 (A:16-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igrfgtslkigivglpnvgkstffnvltnsqasaenfpfctidpnesrvpvpderfdflc
qyhkpaskipaflnvvdiaglvkgahngqglgnaflshisacdgifhltrafedddithv
egsvdpirdieiiheelqlkdeemigpiidklekvavrggdkklkpeydimckvkswvid
qkkpvrfyhdwndkeievlnkhlfltskpmvylvnlsekdyirkknkwlikikewvdkyd
pgalvipfsgalelklqelsaeerqkyleanmtqsalpkiikagfaalq

Sequence, based on observed residues (ATOM records): (download)

>d2ohfa1 c.37.1.0 (A:16-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igrfgtslkigivglpnvgkstffnvltndpnesrvpvpderfdflcqyhkpaskipafl
nvvdiaggnaflshisacdgifhltravdpirdieiiheelqlkdeemigpiidklekva
kpeydimckvkswvidkpvrfyhdwndkeievlnkhlfltskpmvylvnlsekdyirkkn
kwlikikewvdkydpgalvipfsgalelklqelsaeerqkyleanmtqsalpkiikagfa
alq

SCOPe Domain Coordinates for d2ohfa1:

Click to download the PDB-style file with coordinates for d2ohfa1.
(The format of our PDB-style files is described here.)

Timeline for d2ohfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ohfa2