Lineage for d2ogrb_ (2ogr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941147Species Zoanthus sp. [TaxId:105402] [193832] (10 PDB entries)
  8. 2941153Domain d2ogrb_: 2ogr B: [205267]
    automated match to d1xaeb_

Details for d2ogrb_

PDB Entry: 2ogr (more details), 1.8 Å

PDB Description: crystal structure of yellow fluorescent protein from zoanthus sp. at 1.8 a resolution
PDB Compounds: (B:) fluorescent protein fp538

SCOPe Domain Sequences for d2ogrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ogrb_ d.22.1.0 (B:) automated matches {Zoanthus sp. [TaxId: 105402]}
hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala

SCOPe Domain Coordinates for d2ogrb_:

Click to download the PDB-style file with coordinates for d2ogrb_.
(The format of our PDB-style files is described here.)

Timeline for d2ogrb_: