SCOPe 2.07: Domain d2ofxb1: 2ofx B:24-227

Lineage for d2ofxb1 (2ofx B:24-227)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d2ofxb1: 2ofx B:24-227 [205265]
   Other proteins in same PDB: d2ofxa2, d2ofxb2
   automated match to d1m7gc_
   complexed with adp, mg, po4, pps

Details for d2ofxb1

PDB Entry: 2ofx, 1.9 Å

PDB Description: crystal structure of the APSK domain of human PAPSS1 in complex with ADPMg and PAPS

PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d2ofxb1:

Sequence; same for both SEQRES and ATOM records:

>d2ofxb1 c.37.1.0 (B:24-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matnvtyqahhvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipc
ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
tdscdvndcvqqvvellqerdivp

Timeline for d2ofxb1:

• d2ofxb1 first appeared in SCOPe 2.03, called d2ofxb_
  
• d2ofxb1 appears in SCOPe 2.06
  
• d2ofxb1 appears in the current release, SCOPe 2.08