Lineage for d2ofxa1 (2ofx A:24-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872102Domain d2ofxa1: 2ofx A:24-227 [205264]
    Other proteins in same PDB: d2ofxa2, d2ofxb2
    automated match to d1m7gc_
    complexed with adp, mg, po4, pps

Details for d2ofxa1

PDB Entry: 2ofx (more details), 1.9 Å

PDB Description: crystal structure of the APSK domain of human PAPSS1 in complex with ADPMg and PAPS
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d2ofxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofxa1 c.37.1.0 (A:24-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matnvtyqahhvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipc
ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
tdscdvndcvqqvvellqerdivp

SCOPe Domain Coordinates for d2ofxa1:

Click to download the PDB-style file with coordinates for d2ofxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ofxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ofxa2