Lineage for d2ofwf_ (2ofw F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872235Domain d2ofwf_: 2ofw F: [205261]
    automated match to d1m7gc_
    complexed with adx, mg

Details for d2ofwf_

PDB Entry: 2ofw (more details), 2.05 Å

PDB Description: crystal structure of the apsk domain of human papss1 complexed with 2 aps molecules
PDB Compounds: (F:) APS kinase domain of the PAPS synthetase 1

SCOPe Domain Sequences for d2ofwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofwf_ c.37.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipc
ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
tdscdvndcvqqvvellnerdilp

SCOPe Domain Coordinates for d2ofwf_:

Click to download the PDB-style file with coordinates for d2ofwf_.
(The format of our PDB-style files is described here.)

Timeline for d2ofwf_: