| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) |
| Domain d2ofwd_: 2ofw D: [205259] automated match to d1m7gc_ complexed with adx, mg |
PDB Entry: 2ofw (more details), 2.05 Å
SCOPe Domain Sequences for d2ofwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofwd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipc
ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
tdscdvndcvqqvvellnerdilp
Timeline for d2ofwd_: