Lineage for d2ofwd_ (2ofw D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (134 species)
    not a true protein
  7. 2452278Species Human (Homo sapiens) [TaxId:9606] [186862] (128 PDB entries)
  8. 2452343Domain d2ofwd_: 2ofw D: [205259]
    automated match to d1m7gc_
    complexed with adx, mg

Details for d2ofwd_

PDB Entry: 2ofw (more details), 2.05 Å

PDB Description: crystal structure of the apsk domain of human papss1 complexed with 2 aps molecules
PDB Compounds: (D:) APS kinase domain of the PAPS synthetase 1

SCOPe Domain Sequences for d2ofwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofwd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipc
ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
tdscdvndcvqqvvellnerdilp

SCOPe Domain Coordinates for d2ofwd_:

Click to download the PDB-style file with coordinates for d2ofwd_.
(The format of our PDB-style files is described here.)

Timeline for d2ofwd_: