Lineage for d2odqa2 (2odq A:443-730)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (76 PDB entries)
  8. 2390364Domain d2odqa2: 2odq A:443-730 [205255]
    Other proteins in same PDB: d2odqa1
    automated match to d1rrka1
    complexed with nag

Details for d2odqa2

PDB Entry: 2odq (more details), 2.3 Å

PDB Description: Complement component C2a, the catalytic fragment of C3- and C5-convertase of human complement
PDB Compounds: (A:) Complement C2

SCOPe Domain Sequences for d2odqa2:

Sequence, based on SEQRES records: (download)

>d2odqa2 b.47.1.0 (A:443-730) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgvgnmsanasdqertpwhvtikpksqetcrgalisdqwvltaahcfrdgndhslwrvnv
gdpksqwgkefliekavispgfdvfakknqgilefygddiallklaqkvkmstharpicl
pctmeanlalrrpqgstcrdhenellnkqsvpahfvalngsklninlkmgvewtscaevv
sqektmfpnltdvrevvtdqflcsgtqedespckgesggavflerrfrffqvglvswgly
npclgsadknsrkraprskvppprdfhinlfrmqpwlrqhlgdvlnfl

Sequence, based on observed residues (ATOM records): (download)

>d2odqa2 b.47.1.0 (A:443-730) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgvgnmsanasdqertpwhvtikptcrgalisdqwvltaahcfslwrvnvgdpksqwgke
fliekavispgfdvfakknqgilefygddiallklaqkvkmstharpiclpctmeanlal
rrpqgstcrdhenellnkqsvpahfvalngsklninlkmgvewtscaevvsqektmfpnl
tdvrevvtdqflcsgtqedespckgesggavflerrfrffqvglvswglynpclnsrkra
prskvppprdfhinlfrmqpwlrqhlgdvlnfl

SCOPe Domain Coordinates for d2odqa2:

Click to download the PDB-style file with coordinates for d2odqa2.
(The format of our PDB-style files is described here.)

Timeline for d2odqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2odqa1