Lineage for d2odpa2 (2odp A:443-730)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058190Species Human (Homo sapiens) [TaxId:9606] [187421] (73 PDB entries)
  8. 2058206Domain d2odpa2: 2odp A:443-730 [205253]
    Other proteins in same PDB: d2odpa1
    automated match to d1rrka1
    complexed with mg, nag

Details for d2odpa2

PDB Entry: 2odp (more details), 1.9 Å

PDB Description: Complement component C2a, the catalytic fragment of C3- and C5-convertase of human complement
PDB Compounds: (A:) Complement C2

SCOPe Domain Sequences for d2odpa2:

Sequence, based on SEQRES records: (download)

>d2odpa2 b.47.1.0 (A:443-730) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgvgnmsanasdqertpwhvtikpksqetcrgalisdqwvltaahcfrdgndhslwrvnv
gdpksqwgkefliekavispgfdvfakknqgilefygddiallklaqkvkmstharpicl
pctmeanlalrrpqgstcrdhenellnkqsvpahfvalngsklninlkmgvewtscaevv
sqektmfpnltdvrevvtdqflcsgtqedespckgesggavflerrfrffqvglvswgly
npclgsadknsrkraprskvppprdfhinlfrmqpwlrqhlgdvlnfl

Sequence, based on observed residues (ATOM records): (download)

>d2odpa2 b.47.1.0 (A:443-730) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgvgnmsanasdqertpwhvtikptcrgalisdqwvltaahcfwrvnvgdpksqwgkefl
iekavispgfdvfakknqgilefygddiallklaqkvkmstharpiclpctmeanlalrr
pqgstcrdhenellnkqsvpahfvalngsklninlkmgvewtscaevvsqektmfpnltd
vrevvtdqflcsgtqedespckgesggavflerrfrffqvglvswglynpclnsrkrapr
skvppprdfhinlfrmqpwlrqhlgdvlnfl

SCOPe Domain Coordinates for d2odpa2:

Click to download the PDB-style file with coordinates for d2odpa2.
(The format of our PDB-style files is described here.)

Timeline for d2odpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2odpa1