| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
| Family c.62.1.0: automated matches [191586] (1 protein) not a true family |
| Protein automated matches [191045] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries) |
| Domain d2odpa1: 2odp A:224-442 [205252] Other proteins in same PDB: d2odpa2 automated match to d1rrka2 complexed with mg, nag |
PDB Entry: 2odp (more details), 1.9 Å
SCOPe Domain Sequences for d2odpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odpa1 c.62.1.0 (A:224-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiqiqrsghlnlyllldasqsvsendflifkesaslmvdrifsfeinvsvaiitfasepk
vlmsvlndnsrdmtevisslenanykdhengtgtntyaalnsvylmmnnqmrllgmetma
wqeirhaiilltdgksnmggspktavdhireilninqkrndyldiyaigvgkldvdwrel
nelgskkdgerhafilqdtkalhqvfehmldvskltdti
Timeline for d2odpa1: