Lineage for d2odpa1 (2odp A:224-442)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892463Family c.62.1.0: automated matches [191586] (1 protein)
    not a true family
  6. 2892464Protein automated matches [191045] (3 species)
    not a true protein
  7. 2892467Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries)
  8. 2892473Domain d2odpa1: 2odp A:224-442 [205252]
    Other proteins in same PDB: d2odpa2
    automated match to d1rrka2
    complexed with mg, nag

Details for d2odpa1

PDB Entry: 2odp (more details), 1.9 Å

PDB Description: complement component c2a, the catalytic fragment of c3- and c5- convertase of human complement
PDB Compounds: (A:) Complement C2

SCOPe Domain Sequences for d2odpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odpa1 c.62.1.0 (A:224-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiqiqrsghlnlyllldasqsvsendflifkesaslmvdrifsfeinvsvaiitfasepk
vlmsvlndnsrdmtevisslenanykdhengtgtntyaalnsvylmmnnqmrllgmetma
wqeirhaiilltdgksnmggspktavdhireilninqkrndyldiyaigvgkldvdwrel
nelgskkdgerhafilqdtkalhqvfehmldvskltdti

SCOPe Domain Coordinates for d2odpa1:

Click to download the PDB-style file with coordinates for d2odpa1.
(The format of our PDB-style files is described here.)

Timeline for d2odpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2odpa2