Lineage for d2od9a_ (2od9 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360793Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1360794Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1361005Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 1361064Protein automated matches [191258] (2 species)
    not a true protein
  7. 1361065Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225225] (2 PDB entries)
  8. 1361067Domain d2od9a_: 2od9 A: [205251]
    automated match to d1q17c_
    complexed with a1r, nca, zn

Details for d2od9a_

PDB Entry: 2od9 (more details), 2.05 Å

PDB Description: structural basis for nicotinamide inhibition and base exchange in sir2 enzymes
PDB Compounds: (A:) NAD-dependent deacetylase HST2

SCOPe Domain Sequences for d2od9a_:

Sequence, based on SEQRES records: (download)

>d2od9a_ c.31.1.5 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpee
iprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

Sequence, based on observed residues (ATOM records): (download)

>d2od9a_ c.31.1.5 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittqqplvivvgtslavypfaslpeeiprkv
krvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

SCOPe Domain Coordinates for d2od9a_:

Click to download the PDB-style file with coordinates for d2od9a_.
(The format of our PDB-style files is described here.)

Timeline for d2od9a_: