Lineage for d2od7a_ (2od7 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843167Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1843168Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1843434Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 1843493Protein automated matches [191258] (2 species)
    not a true protein
  7. 1843494Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225225] (2 PDB entries)
  8. 1843495Domain d2od7a_: 2od7 A: [205250]
    automated match to d1q17c_
    complexed with a1r, zn

Details for d2od7a_

PDB Entry: 2od7 (more details), 2 Å

PDB Description: crystal structure of yhst2 bound to the intermediate analogue adp-hpd, and and aceylated h4 peptide
PDB Compounds: (A:) NAD-dependent deacetylase HST2

SCOPe Domain Sequences for d2od7a_:

Sequence, based on SEQRES records: (download)

>d2od7a_ c.31.1.5 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpee
iprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

Sequence, based on observed residues (ATOM records): (download)

>d2od7a_ c.31.1.5 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekiqqplvivvgtslavypfaslpeeiprkvkr
vlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

SCOPe Domain Coordinates for d2od7a_:

Click to download the PDB-style file with coordinates for d2od7a_.
(The format of our PDB-style files is described here.)

Timeline for d2od7a_: