Lineage for d2od7a1 (2od7 A:1-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862892Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2862993Protein automated matches [191258] (3 species)
    not a true protein
  7. 2862994Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225225] (2 PDB entries)
  8. 2862995Domain d2od7a1: 2od7 A:1-293 [205250]
    Other proteins in same PDB: d2od7a2
    automated match to d1q17c_
    complexed with a1r, zn

Details for d2od7a1

PDB Entry: 2od7 (more details), 2 Å

PDB Description: crystal structure of yhst2 bound to the intermediate analogue adp-hpd, and and aceylated h4 peptide
PDB Compounds: (A:) NAD-dependent deacetylase HST2

SCOPe Domain Sequences for d2od7a1:

Sequence, based on SEQRES records: (download)

>d2od7a1 c.31.1.5 (A:1-293) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlkl
pypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtl
erqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpa
ivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpeeipr
kvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

Sequence, based on observed residues (ATOM records): (download)

>d2od7a1 c.31.1.5 (A:1-293) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlkl
pypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtl
erqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpa
ivffgedlpdsfsetwlndsewlrekiqqplvivvgtslavypfaslpeeiprkvkrvlc
nletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

SCOPe Domain Coordinates for d2od7a1:

Click to download the PDB-style file with coordinates for d2od7a1.
(The format of our PDB-style files is described here.)

Timeline for d2od7a1: