Lineage for d1bjmb1 (1bjm B:1-111)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102208Species Bence-Jones lambda L chain dimer LOC (human) [48922] (3 PDB entries)
  8. 102210Domain d1bjmb1: 1bjm B:1-111 [20525]
    Other proteins in same PDB: d1bjma2, d1bjmb2

Details for d1bjmb1

PDB Entry: 1bjm (more details), 2.2 Å

PDB Description: loc naks, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in nakso4

SCOP Domain Sequences for d1bjmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjmb1 b.1.1.1 (B:1-111) Immunoglobulin (variable domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

SCOP Domain Coordinates for d1bjmb1:

Click to download the PDB-style file with coordinates for d1bjmb1.
(The format of our PDB-style files is described here.)

Timeline for d1bjmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjmb2