Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
Family b.121.2.0: automated matches [227210] (1 protein) not a true family |
Protein automated matches [226945] (1 species) not a true protein |
Species Simian adenovirus 25 [TaxId:175567] [225294] (1 PDB entry) |
Domain d2obec1: 2obe C:616-929 [205247] automated match to d1p2za2 complexed with 2hp, mpd |
PDB Entry: 2obe (more details), 2.1 Å
SCOPe Domain Sequences for d2obec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2obec1 b.121.2.0 (C:616-929) automated matches {Simian adenovirus 25 [TaxId: 175567]} ndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwsftrlktketpslgsgf dpyfvysgsipyldgtfylnhtfkkvsitfdssvswpgndrlltpnefeikrtvdgegyn vaqcnmtkdwflvqmlahynigyqgfyvpegykdrmysffrnfqpmsrqvvdevnykdyq avtlayqhnnsgfvgylaptmrqgqpypanypypligksavtsvtqkkflcdrvmwripf ssnfmsmgaltdlgqnmlyansahaldmnfevdpmdestllyvvfevfdvvrvhqphrgv ieavylrtpfsagn
Timeline for d2obec1: