SCOPe 2.03: Domain d2obea1: 2obe A:616-929

Lineage for d2obea1 (2obe A:616-929)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.0: automated matches [227210] (1 protein)
   not a true family

6. Protein automated matches [226945] (1 species)
   not a true protein

7. Species Simian adenovirus 25 [TaxId:175567] [225294] (1 PDB entry)

8. Domain d2obea1: 2obe A:616-929 [205245]
   automated match to d1p2za2
   complexed with 2hp, mpd

Details for d2obea1

PDB Entry: 2obe, 2.1 Å

PDB Description: crystal structure of chimpanzee adenovirus (type 68/simian 25) major coat protein hexon

PDB Compounds: (A:) Hexon

SCOPe Domain Sequences for d2obea1:

Sequence; same for both SEQRES and ATOM records:

>d2obea1 b.121.2.0 (A:616-929) automated matches {Simian adenovirus 25 [TaxId: 175567]}
ndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwsftrlktketpslgsgf
dpyfvysgsipyldgtfylnhtfkkvsitfdssvswpgndrlltpnefeikrtvdgegyn
vaqcnmtkdwflvqmlahynigyqgfyvpegykdrmysffrnfqpmsrqvvdevnykdyq
avtlayqhnnsgfvgylaptmrqgqpypanypypligksavtsvtqkkflcdrvmwripf
ssnfmsmgaltdlgqnmlyansahaldmnfevdpmdestllyvvfevfdvvrvhqphrgv
ieavylrtpfsagn

Timeline for d2obea1:

• d2obea1 is new in SCOPe 2.03-stable
  
• d2obea1 appears in SCOPe 2.04
  
• d2obea1 appears in the current release, SCOPe 2.08