![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
![]() | Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) ![]() |
![]() | Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
![]() | Protein Calcium ATPase [81658] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries) Uniprot P04191 |
![]() | Domain d2o9ja4: 2o9j A:361-599 [205242] Other proteins in same PDB: d2o9ja1, d2o9ja2, d2o9ja3 automated match to d1wpga3 complexed with cza, mf4, mg, na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2o9j (more details), 2.65 Å
SCOPe Domain Sequences for d2o9ja4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ja4 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d2o9ja4: