SCOPe 2.03: Domain d2o72a1: 2o72 A:1-101

Lineage for d2o72a1 (2o72 A:1-101)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries)

8. Domain d2o72a1: 2o72 A:1-101 [205235]
   automated match to d1ncja1
   complexed with ca

Details for d2o72a1

PDB Entry: 2o72, 2 Å

PDB Description: crystal structure analysis of human e-cadherin (1-213)

PDB Compounds: (A:) epithelial-cadherin

SCOPe Domain Sequences for d2o72a1:

Sequence; same for both SEQRES and ATOM records:

>d2o72a1 b.1.6.1 (A:1-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
dwvippisspenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwl
kvtepldreriatytlfshavssngnavedpmeilitvtdq

Timeline for d2o72a1:

• d2o72a1 is new in SCOPe 2.03-stable
  
• d2o72a1 appears in SCOPe 2.04
  
• d2o72a1 appears in the current release, SCOPe 2.08