Lineage for d2o5yl2 (2o5y L:108-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034962Domain d2o5yl2: 2o5y L:108-213 [205232]
    Other proteins in same PDB: d2o5yl1
    automated match to d1t66c2
    complexed with so4, str

Details for d2o5yl2

PDB Entry: 2o5y (more details), 2.85 Å

PDB Description: Crystal structure of the 1E9 LeuH47Trp/ArgH100Trp Fab progesterone complex
PDB Compounds: (L:) chimeric antibody Fab 1E9-DB3

SCOPe Domain Sequences for d2o5yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5yl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d2o5yl2:

Click to download the PDB-style file with coordinates for d2o5yl2.
(The format of our PDB-style files is described here.)

Timeline for d2o5yl2: