Lineage for d2o5yl1 (2o5y L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356523Domain d2o5yl1: 2o5y L:1-107 [205231]
    Other proteins in same PDB: d2o5yl2
    automated match to d1t66c1
    complexed with so4, str

Details for d2o5yl1

PDB Entry: 2o5y (more details), 2.85 Å

PDB Description: Crystal structure of the 1E9 LeuH47Trp/ArgH100Trp Fab progesterone complex
PDB Compounds: (L:) chimeric antibody Fab 1E9-DB3

SCOPe Domain Sequences for d2o5yl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5yl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleik

SCOPe Domain Coordinates for d2o5yl1:

Click to download the PDB-style file with coordinates for d2o5yl1.
(The format of our PDB-style files is described here.)

Timeline for d2o5yl1: