| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d2o5yl1: 2o5y L:1-107 [205231] Other proteins in same PDB: d2o5yl2 automated match to d1t66c1 complexed with so4, str |
PDB Entry: 2o5y (more details), 2.85 Å
SCOPe Domain Sequences for d2o5yl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o5yl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleik
Timeline for d2o5yl1: