SCOPe 2.08: Domain d2o5xl2: 2o5x L:108-213

Lineage for d2o5xl2 (2o5x L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2o5xl2: 2o5x L:108-213 [205230]
   Other proteins in same PDB: d2o5xl1
   automated match to d1t66c2
   complexed with so4, trs

Details for d2o5xl2

PDB Entry: 2o5x, 2.05 Å

PDB Description: Crystal structure of 1E9 LeuH47Trp/ArgH100Trp, an engineered Diels-Alderase Fab with nM steroid-binding affinity

PDB Compounds: (L:) chimeric antibody Fab 1E9-DB3

SCOPe Domain Sequences for d2o5xl2:

Sequence; same for both SEQRES and ATOM records:

>d2o5xl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d2o5xl2:

• d2o5xl2 first appeared in SCOPe 2.03
  
• d2o5xl2 appears in SCOPe 2.07