SCOP 1.73: Domain d2rhea_: 2rhe A:

Lineage for d2rhea_ (2rhe A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (9 PDB entries)

8. Domain d2rhea_: 2rhe A: [20523]
   VL of Bence-Jones protein RHE

Details for d2rhea_

PDB Entry: 2rhe, 1.6 Å

PDB Description: structure of a novel bence-jones protein (rhe) fragment at 1.6 angstroms resolution

PDB Compounds: (A:) bence-jones protein rhe (light chain)

SCOP Domain Sequences for d2rhea_:

Sequence; same for both SEQRES and ATOM records:

>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
esvltqppsasgtpgqrvtisctgsatdigsnsviwyqqvpgkapklliyyndllpsgvs
drfsasksgtsaslaisglesedeadyycaawndsldepgfgggtkltvlgqpk

Timeline for d2rhea_:

• d2rhea_ first appeared (with stable ids) in SCOP 1.55, called d2rhe__
  
• d2rhea_ was called d2rhe__ in SCOP 1.71
  
• d2rhea_ appears in SCOP 1.75
  
• d2rhea_ appears in the current release, SCOPe 2.08