Lineage for d2rhe__ (2rhe -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Bence-Jones VL (lambda) dimer RHE (human) [48921] (1 PDB entry) 
Domain d2rhe__: 2rhe - [20523]
Details for d2rhe__
PDB Entry: 2rhe (more details), 1.6 Å
PDB Description: structure of a novel bence-jones protein (rhe) fragment at 1.6 angstroms resolution
SCOP Domain Sequences for d2rhe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhe__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (lambda) dimer RHE (human)}
esvltqppsasgtpgqrvtisctgsatdigsnsviwyqqvpgkapklliyyndllpsgvs
drfsasksgtsaslaisglesedeadyycaawndsldepgfgggtkltvlgqpk
SCOP Domain Coordinates for d2rhe__:
Click to download the PDB-style file with coordinates for d2rhe__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rhe__:
- d2rhe__ appears in SCOP 1.57
- d2rhe__ appears in the current release, SCOPe 2.08, called d2rhea_
View in 3D