Lineage for d2rhea_ (2rhe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741627Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)
  8. 2741630Domain d2rhea_: 2rhe A: [20523]
    VL of Bence-Jones protein RHE

Details for d2rhea_

PDB Entry: 2rhe (more details), 1.6 Å

PDB Description: structure of a novel bence-jones protein (rhe) fragment at 1.6 angstroms resolution
PDB Compounds: (A:) bence-jones protein rhe (light chain)

SCOPe Domain Sequences for d2rhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
esvltqppsasgtpgqrvtisctgsatdigsnsviwyqqvpgkapklliyyndllpsgvs
drfsasksgtsaslaisglesedeadyycaawndsldepgfgggtkltvlgqpk

SCOPe Domain Coordinates for d2rhea_:

Click to download the PDB-style file with coordinates for d2rhea_.
(The format of our PDB-style files is described here.)

Timeline for d2rhea_: