Lineage for d2o5ra2 (2o5r A:313-468)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742282Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1742283Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 1742310Family a.97.1.0: automated matches [227179] (1 protein)
    not a true family
  6. 1742311Protein automated matches [226898] (4 species)
    not a true protein
  7. 1742320Species Thermotoga maritima [TaxId:2336] [225199] (2 PDB entries)
  8. 1742322Domain d2o5ra2: 2o5r A:313-468 [205228]
    Other proteins in same PDB: d2o5ra1
    automated match to d1j09a1
    complexed with cl, gol

Details for d2o5ra2

PDB Entry: 2o5r (more details), 2.34 Å

PDB Description: crystal structure of glutamyl-trna synthetase 1 (ec 6.1.1.17) (glutamate-trna ligase 1) (glurs 1) (tm1351) from thermotoga maritima at 2.5 a resolution
PDB Compounds: (A:) Glutamyl-tRNA synthetase 1

SCOPe Domain Sequences for d2o5ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5ra2 a.97.1.0 (A:313-468) automated matches {Thermotoga maritima [TaxId: 2336]}
dpqklkwmngyylrnmpieklaelakpffekagikiideeyfkkvleitkervevlsefp
eesrfffedpapveipeemkevfsqlkeelqnvrwtmeeitpvfkkvlkqhgvkpkefym
tlrrvltgreegpelvniipllgkeiflrrierslg

SCOPe Domain Coordinates for d2o5ra2:

Click to download the PDB-style file with coordinates for d2o5ra2.
(The format of our PDB-style files is described here.)

Timeline for d2o5ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o5ra1