Class a: All alpha proteins [46456] (286 folds) |
Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) |
Family a.97.1.0: automated matches [227179] (1 protein) not a true family |
Protein automated matches [226898] (4 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [225199] (2 PDB entries) |
Domain d2o5ra2: 2o5r A:313-468 [205228] Other proteins in same PDB: d2o5ra1 automated match to d1j09a1 complexed with cl, gol |
PDB Entry: 2o5r (more details), 2.34 Å
SCOPe Domain Sequences for d2o5ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o5ra2 a.97.1.0 (A:313-468) automated matches {Thermotoga maritima [TaxId: 2336]} dpqklkwmngyylrnmpieklaelakpffekagikiideeyfkkvleitkervevlsefp eesrfffedpapveipeemkevfsqlkeelqnvrwtmeeitpvfkkvlkqhgvkpkefym tlrrvltgreegpelvniipllgkeiflrrierslg
Timeline for d2o5ra2: