Lineage for d2o56h2 (2o56 H:123-397)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446361Species Salmonella typhimurium [TaxId:99287] [225194] (1 PDB entry)
  8. 2446369Domain d2o56h2: 2o56 H:123-397 [205226]
    Other proteins in same PDB: d2o56a1, d2o56a3, d2o56b1, d2o56b3, d2o56c1, d2o56c3, d2o56d1, d2o56d3, d2o56e1, d2o56e3, d2o56f1, d2o56f3, d2o56g1, d2o56g3, d2o56h1, d2o56h3
    automated match to d2gl5a1
    complexed with mg

Details for d2o56h2

PDB Entry: 2o56 (more details), 2 Å

PDB Description: crystal structure of a member of the enolase superfamily from salmonella typhimurium
PDB Compounds: (H:) Putative mandelate racemase

SCOPe Domain Sequences for d2o56h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o56h2 c.1.11.0 (H:123-397) automated matches {Salmonella typhimurium [TaxId: 99287]}
ksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnw
nqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgif
yyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggit
evkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtcky
nylpkngmyevpelpgigqelteetmkksptitvk

SCOPe Domain Coordinates for d2o56h2:

Click to download the PDB-style file with coordinates for d2o56h2.
(The format of our PDB-style files is described here.)

Timeline for d2o56h2: