SCOPe 2.08: Domain d2o56f1: 2o56 F:2-122

Lineage for d2o56f1 (2o56 F:2-122)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [225193] (1 PDB entry)

8. Domain d2o56f1: 2o56 F:2-122 [205221]
   Other proteins in same PDB: d2o56a2, d2o56a3, d2o56b2, d2o56b3, d2o56c2, d2o56c3, d2o56d2, d2o56d3, d2o56e2, d2o56e3, d2o56f2, d2o56f3, d2o56g2, d2o56g3, d2o56h2, d2o56h3
   automated match to d2gl5a2
   complexed with mg

Details for d2o56f1

PDB Entry: 2o56, 2 Å

PDB Description: crystal structure of a member of the enolase superfamily from salmonella typhimurium

PDB Compounds: (F:) Putative mandelate racemase

SCOPe Domain Sequences for d2o56f1:

Sequence, based on SEQRES records:

>d2o56f1 d.54.1.0 (F:2-122) automated matches {Salmonella typhimurium [TaxId: 99287]}
mkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmakdls
aiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlg
g

Sequence, based on observed residues (ATOM records):

>d2o56f1 d.54.1.0 (F:2-122) automated matches {Salmonella typhimurium [TaxId: 99287]}
mkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiiig
mdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlgg

Timeline for d2o56f1:

• d2o56f1 first appeared in SCOPe 2.03
  
• d2o56f1 appears in SCOPe 2.07