Lineage for d1ar2a_ (1ar2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740778Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 2740821Domain d1ar2a_: 1ar2 A: [20522]
    VL of Bence-Jones protein REI; disulfide-free mutant

Details for d1ar2a_

PDB Entry: 1ar2 (more details), 2.8 Å

PDB Description: disulfide-free immunoglobulin fragment
PDB Compounds: (A:) rei

SCOPe Domain Sequences for d1ar2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar2a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
tpdiqmtqspsslsasvgdrvtitvqasqdiikhlnwyqqtpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

SCOPe Domain Coordinates for d1ar2a_:

Click to download the PDB-style file with coordinates for d1ar2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ar2a_: