Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [225193] (1 PDB entry) |
Domain d2o56b1: 2o56 B:2-122 [205213] Other proteins in same PDB: d2o56a2, d2o56a3, d2o56b2, d2o56b3, d2o56c2, d2o56c3, d2o56d2, d2o56d3, d2o56e2, d2o56e3, d2o56f2, d2o56f3, d2o56g2, d2o56g3, d2o56h2, d2o56h3 automated match to d2gl5a2 complexed with mg |
PDB Entry: 2o56 (more details), 2 Å
SCOPe Domain Sequences for d2o56b1:
Sequence, based on SEQRES records: (download)
>d2o56b1 d.54.1.0 (B:2-122) automated matches {Salmonella typhimurium [TaxId: 99287]} mkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmakdls aiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlg g
>d2o56b1 d.54.1.0 (B:2-122) automated matches {Salmonella typhimurium [TaxId: 99287]} mkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiiig mdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlgg
Timeline for d2o56b1: