SCOPe 2.08: Domain d2o52a_: 2o52 A:

Lineage for d2o52a_ (2o52 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2o52a_: 2o52 A: [205209]
   automated match to d2bmda1
   complexed with bme, gdp, mg, unx

Details for d2o52a_

PDB Entry: 2o52, 2.2 Å

PDB Description: crystal structure of human rab4b in complex with gdp

PDB Compounds: (A:) Ras-related protein Rab-4B

SCOPe Domain Sequences for d2o52a_:

Sequence, based on SEQRES records:

>d2o52a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdflfkflvigsagtgkscllhqfienkfkqdsnhtigvefgsrvvnvggktvklqiwdt
agqerfrsvtrsyyrgaagallvyditsretynslaawltdartlaspnivvilcgnkkd
ldperevtfleasrfaqenelmfletsaltgenveeaflkcartilnkidsgeldperm

Sequence, based on observed residues (ATOM records):

>d2o52a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdflfkflvigsagtgkscllhqfievefgsrvvnvggktvklqiwdtagqerfrsvtrs
yyrgaagallvyditsretynslaawltdartlaspnivvilcgnkkdldperevtflea
srfaqenelmfletsaltgenveeaflkcartilnkidsgeldperm

Timeline for d2o52a_:

• d2o52a_ first appeared in SCOPe 2.03
  
• d2o52a_ appears in SCOPe 2.07