Lineage for d2o2ta_ (2o2t A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312126Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1312127Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1312128Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1312237Protein Multiple PDZ domain protein [141267] (1 species)
  7. 1312238Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries)
    Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042
  8. 1312245Domain d2o2ta_: 2o2t A: [205207]
    automated match to d3axab_

Details for d2o2ta_

PDB Entry: 2o2t (more details), 2.7 Å

PDB Description: The crystal structure of the 1st PDZ domain of MPDZ
PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2o2ta_:

Sequence, based on SEQRES records: (download)

>d2o2ta_ b.36.1.1 (A:) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
cdefdqliknmaqgrhvevfellkppsgglgfsvvglrsenrgelgifvqeiqegsvahr
dgrlketdqilaingqaldqtithqqaisilqkakdtvqlviargslpqyykv

Sequence, based on observed residues (ATOM records): (download)

>d2o2ta_ b.36.1.1 (A:) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
cdefdqliknmaqgrhvevfellkppsgglgfsvvglrsenelgifvqeiqegsvahrdg
rlketdqilaingqaldqtithqqaisilqkakdtvqlviargslpqyykv

SCOPe Domain Coordinates for d2o2ta_:

Click to download the PDB-style file with coordinates for d2o2ta_.
(The format of our PDB-style files is described here.)

Timeline for d2o2ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2o2tb_