Lineage for d2o1za_ (2o1z A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990408Species Plasmodium vivax [TaxId:5855] [226817] (1 PDB entry)
  8. 1990409Domain d2o1za_: 2o1z A: [205205]
    automated match to d4djnb_
    complexed with fe, unx

Details for d2o1za_

PDB Entry: 2o1z (more details), 2.4 Å

PDB Description: plasmodium vivax ribonucleotide reductase subunit r2 (pv086155)
PDB Compounds: (A:) Ribonucleotide Reductase Subunit R2

SCOPe Domain Sequences for d2o1za_:

Sequence, based on SEQRES records: (download)

>d2o1za_ a.25.1.2 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
kkfsdlqkskeanekilsketdrftlypilypdvwdfykkaeasfwtaeeidlssdlkdf
eklndnekhfikhvlaffaasdgivlenlaskflrqvkiteakkfyafqiavenihsety
sllidnyikdekermnlfhaienipavknkalwaakwindtnsfaerivanacvegilfs
gsfcaifwfkkqnklhgltfsnelisrdeglhtdfncliysllenklpeevvqnivkeav
eversficeslpcdligmnsrlmsqyiefvadrlleclgspkifhaknpfnwmdl

Sequence, based on observed residues (ATOM records): (download)

>d2o1za_ a.25.1.2 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
kkfsdlqkskeanekilsketdrftlypilypdvwdfykkaeasfwtaeeidlssdlkdf
eklndnekhfikhvlaffaaslaskflrqvkiteakkfyafqiavenihsetysllidny
ikdekermnlfhaienipavknkalwaakwindtnsfaerivanacvegilfsgsfcaif
wfkkqnklhgltfsnelisrdeglhtdfncliysllenklpeevvqnivkeaveversfi
ceslpcdligmnsrlmsqyiefvadrlleclgspkifhaknpfnwmdl

SCOPe Domain Coordinates for d2o1za_:

Click to download the PDB-style file with coordinates for d2o1za_.
(The format of our PDB-style files is described here.)

Timeline for d2o1za_: