Lineage for d2o1ba_ (2o1b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132906Species Staphylococcus aureus [TaxId:1280] [225192] (1 PDB entry)
  8. 2132907Domain d2o1ba_: 2o1b A: [205204]
    automated match to d1vp4b_
    complexed with plp

Details for d2o1ba_

PDB Entry: 2o1b (more details), 1.95 Å

PDB Description: Structure of aminotransferase from Staphylococcus aureus
PDB Compounds: (A:) Aminotransferase, class I

SCOPe Domain Sequences for d2o1ba_:

Sequence, based on SEQRES records: (download)

>d2o1ba_ c.67.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
isnklanipdsyfgktmgrkiehgplplinmavgipdgptpqgiidhfqkaltipenqky
gafhgkeafkqaivdfyqrqynvtldkedevcilygtknglvavptcvinpgdyvllpdp
gytdylagvlladgkpvplnlepphylpdwskvdsqiidktkliyltypnnptgstatke
vfdeaiakfkgtdtkivhdfaygafgfdaknpsilasengkdvaieiyslskgynmsgfr
vgfavgnkdmiqalkkyqthtnagmfgalqdaaiyalnhyddfleeqsnvfktrrdrfea
mlakadlpfvhakggiyvwletppgydseqfeqflvqeksilvapgkpfgengnryvris
lalddqkldeaairltelaylye

Sequence, based on observed residues (ATOM records): (download)

>d2o1ba_ c.67.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
isnklanipdsyfgehgplplinmavgipdgptpqgiidhfqkaltipenqkygafhgke
afkqaivdfyqrqynvtldkedevcilygtknglvavptcvinpgdyvllpdpgytdyla
gvlladgkpvplnlepphylpdwskvdsqiidktkliyltypnnptgstatkevfdeaia
kfkgtdtkivhdfaygafgfdaknpsilasengkdvaieiyslskgynmsgfrvgfavgn
kdmiqalkkyqthtnagmfgalqdaaiyalnhyddfleeqsnvfktrrdrfeamlakadl
pfvhakggiyvwletppgydseqfeqflvqeksilvapgkpfgengnryvrislalddqk
ldeaairltelaylye

SCOPe Domain Coordinates for d2o1ba_:

Click to download the PDB-style file with coordinates for d2o1ba_.
(The format of our PDB-style files is described here.)

Timeline for d2o1ba_: