Lineage for d2nz2a2 (2nz2 A:172-407)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563173Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2563174Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2563220Family d.210.1.0: automated matches [227194] (1 protein)
    not a true family
  6. 2563221Protein automated matches [226921] (4 species)
    not a true protein
  7. 2563224Species Human (Homo sapiens) [TaxId:9606] [225191] (1 PDB entry)
  8. 2563225Domain d2nz2a2: 2nz2 A:172-407 [205203]
    Other proteins in same PDB: d2nz2a1
    automated match to d1vl2a2
    complexed with asp, cir, na

Details for d2nz2a2

PDB Entry: 2nz2 (more details), 2.4 Å

PDB Description: crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d2nz2a2:

Sequence, based on SEQRES records: (download)

>d2nz2a2 d.210.1.0 (A:172-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvtpknpwsmdenlmhisyeagilenpknqappglytktqdpakapntpdileiefkkgv
pvkvtnvkdgtthqtslelfmylnevagkhgvgridivenrfigmksrgiyetpagtily
hahldieaftmdrevrkikqglglkfaelvytgfwhspecefvrhciaksqervegkvqv
svlkgqvyilgresplslyneelvsmnvqgdyeptdatgfininslrlkeyhrlqs

Sequence, based on observed residues (ATOM records): (download)

>d2nz2a2 d.210.1.0 (A:172-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvtpknpwsmdenlmhisyeagilenpknqappglytktqdpakapntpdileiefkkgv
pvkvtnvkdgtthqtslelfmylnevagkhgvgridivenrfigmksrgiyetpagtily
hahldieaftmdrevrkikqglglkfaelvytgfwhspecefvrhciaksqervegkvqv
svlkgqvyilgresplslyneelvsnvqgdyeptdatgfininslrlkeyhrlqs

SCOPe Domain Coordinates for d2nz2a2:

Click to download the PDB-style file with coordinates for d2nz2a2.
(The format of our PDB-style files is described here.)

Timeline for d2nz2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nz2a1