SCOP 1.75: Domain d1reia_: 1rei A:

Lineage for d1reia_ (1rei A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)

8. Domain d1reia_: 1rei A: [20520]
   VL dimer of Bence-Jones protein REI

Details for d1reia_

PDB Entry: 1rei, 2 Å

PDB Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution

PDB Compounds: (A:) bence-jones protein rei (light chain)

SCOP Domain Sequences for d1reia_:

Sequence; same for both SEQRES and ATOM records:

>d1reia_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

Timeline for d1reia_:

• d1reia_ first appeared (with stable ids) in SCOP 1.55
  
• d1reia_ appears in SCOP 1.73
  
• d1reia_ appears in SCOPe 2.01
  
• d1reia_ appears in the current release, SCOPe 2.08