Lineage for d1reia_ (1rei A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157675Species Bence-Jones VL (kappa) dimer REI (human) [48920] (3 PDB entries)
  8. 157678Domain d1reia_: 1rei A: [20520]

Details for d1reia_

PDB Entry: 1rei (more details), 2 Å

PDB Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution

SCOP Domain Sequences for d1reia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reia_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer REI (human)}
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

SCOP Domain Coordinates for d1reia_:

Click to download the PDB-style file with coordinates for d1reia_.
(The format of our PDB-style files is described here.)

Timeline for d1reia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1reib_