SCOP 1.55: Domain d1reia_: 1rei A:

Lineage for d1reia_ (1rei A:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Bence-Jones VL (kappa) dimer REI (human) [48920] (3 PDB entries)

8. Domain d1reia_: 1rei A: [20520]

Details for d1reia_

PDB Entry: 1rei, 2 Å

PDB Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution

SCOP Domain Sequences for d1reia_:

Sequence; same for both SEQRES and ATOM records:

>d1reia_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer REI (human)}
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

Timeline for d1reia_:

• d1reia_ appears in SCOP 1.57
  
• d1reia_ appears in the current release, SCOPe 2.07