Lineage for d1reia_ (1rei A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740778Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 2740797Domain d1reia_: 1rei A: [20520]
    VL dimer of Bence-Jones protein REI

Details for d1reia_

PDB Entry: 1rei (more details), 2 Å

PDB Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution
PDB Compounds: (A:) bence-jones protein rei (light chain)

SCOPe Domain Sequences for d1reia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reia_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

SCOPe Domain Coordinates for d1reia_:

Click to download the PDB-style file with coordinates for d1reia_.
(The format of our PDB-style files is described here.)

Timeline for d1reia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1reib_