Lineage for d2nw2a1 (2nw2 A:1-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365590Domain d2nw2a1: 2nw2 A:1-117 [205197]
    Other proteins in same PDB: d2nw2a2
    automated match to d2esvd1

Details for d2nw2a1

PDB Entry: 2nw2 (more details), 1.4 Å

PDB Description: Crystal structure of ELS4 TCR at 1.4A
PDB Compounds: (A:) ELS4 TCR alpha chain

SCOPe Domain Sequences for d2nw2a1:

Sequence, based on SEQRES records: (download)

>d2nw2a1 b.1.1.0 (A:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavqasggsyiptfgrgtslivhpy

Sequence, based on observed residues (ATOM records): (download)

>d2nw2a1 b.1.1.0 (A:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavqaggsyiptfgrgtslivhpy

SCOPe Domain Coordinates for d2nw2a1:

Click to download the PDB-style file with coordinates for d2nw2a1.
(The format of our PDB-style files is described here.)

Timeline for d2nw2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nw2a2