SCOPe 2.06: Domain d2nvvd1: 2nvv D:2-218

Lineage for d2nvvd1 (2nvv D:2-218)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (14 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:242619] [225221] (1 PDB entry)

8. Domain d2nvvd1: 2nvv D:2-218 [205191]
   automated match to d2g39a1
   complexed with zn

Details for d2nvvd1

PDB Entry: 2nvv, 2.7 Å

PDB Description: Crystal Structure of the Putative Acetyl-CoA hydrolase/transferase PG1013 from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR16.

PDB Compounds: (D:) Acetyl-CoA hydrolase/transferase family protein

SCOPe Domain Sequences for d2nvvd1:

Sequence; same for both SEQRES and ATOM records:

>d2nvvd1 c.124.1.0 (D:2-218) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga
stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd
vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa
rrelpvytpsdrigkpyvqvdpakivgvvrtsepnde

Timeline for d2nvvd1:

• d2nvvd1 first appeared in SCOPe 2.03
  
• d2nvvd1 appears in SCOPe 2.05
  
• d2nvvd1 appears in SCOPe 2.07
  
• d2nvvd1 appears in the current release, SCOPe 2.08