![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
![]() | Protein automated matches [191112] (17 species) not a true protein |
![]() | Species Porphyromonas gingivalis [TaxId:242619] [225221] (1 PDB entry) |
![]() | Domain d2nvvc2: 2nvv C:219-497 [205190] automated match to d2g39a2 complexed with zn |
PDB Entry: 2nvv (more details), 2.7 Å
SCOPe Domain Sequences for d2nvvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvvc2 c.124.1.0 (C:219-497) automated matches {Porphyromonas gingivalis [TaxId: 242619]} sdfapldpvtqaigdnvaaflvsemkagripkdflplqsgvgnvanavlgalgdnpdipa fnmyteviqdavialmkkgrikfasgcslsvsrsviqdiyanldffkdkillrpqeysnn peivrrlgvitintaleadifgninsthvsgtrmmngiggsgdftrnsyvsifttpsvmk dgkissfvpmvahhdhsehsvkviisewgvadlrgknpreraheiidkcvhpdyrpllrq ylelgvkgqtpqnldccfafhqelaksgdmrnvrwedym
Timeline for d2nvvc2: