SCOP 1.55: Domain d1bwwb_: 1bww B:

Lineage for d1bwwb_ (1bww B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Bence-Jones VL (kappa) dimer REI (human) [48920] (3 PDB entries)

8. Domain d1bwwb_: 1bww B: [20519]

Details for d1bwwb_

PDB Entry: 1bww, 1.7 Å

PDB Description: bence-jones immunoglobulin rei variable portion, t39k mutant

SCOP Domain Sequences for d1bwwb_:

Sequence; same for both SEQRES and ATOM records:

>d1bwwb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer REI (human)}
tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

Timeline for d1bwwb_:

• d1bwwb_ appears in SCOP 1.57
  
• d1bwwb_ appears in the current release, SCOPe 2.08