Lineage for d1bwwb_ (1bww B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740778Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 2740780Domain d1bwwb_: 1bww B: [20519]
    VL dimer of Bence-Jones protein REI
    mutant

Details for d1bwwb_

PDB Entry: 1bww (more details), 1.7 Å

PDB Description: bence-jones immunoglobulin rei variable portion, t39k mutant
PDB Compounds: (B:) protein (ig kappa chain v-I region rei)

SCOPe Domain Sequences for d1bwwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwwb_ b.1.1.1 (B:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

SCOPe Domain Coordinates for d1bwwb_:

Click to download the PDB-style file with coordinates for d1bwwb_.
(The format of our PDB-style files is described here.)

Timeline for d1bwwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bwwa_